PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C012105P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 308aa    MW: 34795.5 Da    PI: 7.1656
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C012105P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-1696141147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l ++v+++G+ +W++Ia+++  gR++k+c++rw++ 
   MELO3C012105P1  96 RGHWRPAEDTKLRELVALYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 141
                      899*****************************.***********996 PP

2Myb_DNA-binding56.27.9e-18148191146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++eE+e+l +a++ +G++ W+ Iar ++ gRt++ +k++w+ 
   MELO3C012105P1 148 RRAFSEEEEERLMQAHRIYGNK-WAMIARLFP-GRTDNAVKNHWHV 191
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.01191142IPR017930Myb domain
SMARTSM007174.6E-1495144IPR001005SANT/Myb domain
PfamPF002494.9E-1696141IPR001005SANT/Myb domain
SuperFamilySSF466893.11E-2896189IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-2597149IPR009057Homeodomain-like
CDDcd001679.64E-1399140No hitNo description
PROSITE profilePS5129426.929143197IPR017930Myb domain
SMARTSM007171.8E-14147195IPR001005SANT/Myb domain
PfamPF002491.6E-14148190IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.2E-21150196IPR009057Homeodomain-like
CDDcd001672.05E-11150190No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MGMFTDEDEE SFNLDLNSAA IFSSSSQESC EEINGRAFWN FPFSCESDIV NNNNNNNNGG  60
SEFSDGLNQN AANNPTSCSN NTPSSSTGAQ SRLCARGHWR PAEDTKLREL VALYGPQNWN  120
LIAEKLEGRS GKSCRLRWFN QLDPRINRRA FSEEEEERLM QAHRIYGNKW AMIARLFPGR  180
TDNAVKNHWH VIMARKYREQ SRCYRRRKLS QSVYRKMEED LSFLNIPKDH NHHDKITAAA  240
AATTTSCSSF GNFEGCVDYA FLRQMGIGGG GETMSSNYNI TPNYPYFNSC AHLSTLNVLP  300
GLNLFSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-33941965107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818960.0LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
GenBankLN7132640.0LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008446370.10.0PREDICTED: transcription factor MYB108
TrEMBLA0A0A0KQN10.0A0A0A0KQN1_CUCSA; Uncharacterized protein
STRINGVIT_01s0026g02600.t011e-93(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.14e-76myb domain protein 105